葡京网站手机网址news center

2019-03-02 10:18:05

Nicotine patches may boost intensive care risk

ByRoxanneKhamsiNicotinegiventointensivecarepatientstoeasetheirwithdrawalfromcigarettesmayputthematagreaterriskofdeaththangoing“coldturkey”

2019-03-02 09:05:05

Interview: Traditional medicine, novel partnership

ByBrianVastag(Image:DavidAgnello)AsanethnobotanistworkingwiththetraditionalhealersofSamoainthe1980s

2019-03-02 08:17:07

The rules of contagion

ByBobHolmesFRANCE

2019-03-02 08:13:08

Histories: The human centrifuge

ByStephaniePain“Hiscountenanceattachedtosaturnineblackness

2019-03-02 08:13:07

New strain of H5N1 bird flu emerges in China

ByDeboraMacKenzieAnewstrainofH5N1birdfluhasemergedinChinathatispoisedtostartyetanotherglobalwaveofinfection.NearlythreetimesasmanyChinesepoultryareinfectedwithH5N1nowthanlastyear

2019-03-02 06:13:05

Libyan AIDS trial resumes, and adjourns

ByNewScientistandAFPTheretrialoffiveBulgariannursesandaPalestiniandoctoraccusedofinfectinghundredsofLibyanchildrenwiththeHIVvirusheardrenewedaccusationsoftortureonTuesday

2019-03-02 06:11:01

Brain defect may cause 50% of cot deaths

ByLindaGeddesStructuralabnormalitiesinababy’sbrainstemmayliebehindabouthalfthecasesofsuddeninfantdeathsyndrome(SIDS).HannahKinneyandDavidPatersonattheChildren’sHospitalinBoston

2019-03-02 06:05:04

WHO blasts China for withholding bird flu samples

ByNewScientistandAFPChina’slackoftransparencyoveritshandlingofbirdfluismakingitdifficulttodeterminehowthedeadlyvirusismutatingandspreading

2019-03-02 06:04:04

Tame your brain to keep your cool

ITSEEMSthatemotionalself-controlreallydoescomefromwithin.Previousstudieshaveshownthatpeoplecanlearntocontroltheactivitylevelsofspecificbrainregionstoalter

2019-03-02 06:02:06

Should people be tested for mad cow disease?

ByWouldyouwanttoknowifyouwerecarryinghumanmadcowdisease?Maybenot

2019-03-02 05:11:03

Bird flu outruns the vaccines

ByDeboraMackenzieANEWstrainofH5N1birdfluhasemergedinChinaandispoisedtostartyetanotherglobalwaveofinfection.Thehumanpandemicvaccinesnowbeingdevelopedwillnotprotectagainstit.Worsestill

2019-03-02 05:05:06

IBM factories linked to boosted cancer risk

AcontroversialpaperclaimingthatIBMfactoryworkershaveahigherriskofdevelopingcancerhasfinallyseenthelightofday.In2002

2019-03-02 05:04:04

Muscle wasting prevented by protein-blocker

ByRoxanneKhamsiMusclewastingmayonedaybepreventedbytakingadrugthatblockstheactionofakeyproteininvolvedininflammation

2019-03-02 05:02:08

Could surgeons use headlights in place of lasers?

ByPaulMarksItwasareallight-bulbmomentforJeffreyGordonandhisteam.Theyhaddevelopedadevicethatwouldusesunlightratherthanexpensivelaserstoperformsurgicalproceduressuchaszappingtumours

2019-03-02 04:20:07

The word: Mud volcano

ITUSEDtobethatnoself-respectingvisitortoAzerbaijanwouldleavewithoutwallowinginthegooey

2019-03-02 04:12:01

Global survey puts reproductive health on the map

ByGaiaVinceMarriagemaybegoodforyoursexlife

2019-03-02 04:06:02

Stem cell research: Dangerous territory?

ByPaulBillingsCALIFORNIA’sStemCellResearchandCuresAct

2019-03-02 04:03:05

The 10 roads to Fatsville

ByAlisonMotlukAskanyonewhythereisanobesityepidemicandtheywilltellyouthatit’salldowntoeatingtoomuchandburningtoofewcalories.Thatisundoubtedlytrue–youcannotgetroundthefirstlawofthermodynamics.It’salsotr

2019-03-02 03:12:01

葡京网站手机网址:Should people be tested for mad cow disease?

WOULDyouwanttoknowifyouwerecarryinghumanmadcowdisease?Maybenot

2019-03-02 02:15:03

SIDS deaths linked to brain defect

ByLindaGeddesSTRUCTURALabnormalitiesinababy’sbrainstemmayliebehindaroundhalfthecasesofsuddeninfantdeathsyndrome.HannahKinneyandDavidPatersonattheChildren’sHospitalBostonexaminedthebrainsof31infantswho

2019-03-02 02:15:02

Alzheimer's alert over anaesthetics

ByHelenPhillipsGivingelderlypatientscertaingeneralanaestheticscouldincreasetheirriskofdevelopingAlzheimer’sdiseaseandothermemoryandattentionproblems.Thesuggestionarisesfromrecenttesttubeandanimalexper

2019-03-02 01:09:08

Going to Mars? Don't forget to pack gravity

ByLewisDartnellFloatingaroundinmicrogravityinsideaspacecraftmightlooklikefun

2019-03-02 01:09:01

Vaccine protects mice against MRSA superbug

ByRoxanneKhamsiAnewlydevelopedvaccinemightserveasausefulweaponagainstthedrug-resistantsuperbugMRSA

2019-03-02 01:08:08

Profile of a sexsomniac

ByJessicaMarshallTHEfirsttimeithappened

2019-03-02 01:08:06

葡京网站手机网址:Fresh ammo to kill rogue prions

ITISarayofhopeinthebattleagainstpriondiseasessuchasvCJD

2019-03-01 10:03:08

Too much screen time is bad for active kids too

ByNicFlemingChildrenwhowatchTVorplaycomputergamesfor2 hoursormoreadayaremorelikelytohavepoorconcentration

2019-03-01 09:19:02

Video highlights best candidates for IVF

ByJessicaHamzelouVideo:EmbryosdivideThesuccessrateofIVFcouldbeimprovedfollowingvideofootageofdevelopingearly-stageembryos.ReneeReijoPera’sgroupatStanfordUniversityinCaliforniafilmedthedevelopmentof

2019-03-01 09:17:04

葡京网站手机网址:First person treated in milestone stem cell trial

ByAndyCoghlanApersonwithspinalinjuriestodaywentdowninhistoryasthefirsttoreceiveatreatmentderivedfromhumanembryonicstemcells(hESCs).Manypeoplehavealreadybeentreatedwithstemcellsoriginatingfromadulttiss

2019-03-01 09:14:07

葡京网站手机网址:Australia blames a flu vaccine for child convulsions

ByDeboraMacKenzieAsthenorthernhemispherebracesitselfforthefluseason

2019-03-01 09:08:05

Thighs and abs have a different take on fat

ByDeboraMacKenzieAsmanywomenwillnodoubtattest

2019-03-01 09:07:02

Cellphones reveal emerging disease outbreaks

ByJimGilesYOURcellphonecouldbeakeytoolinthefightagainstdiseasebyrelayingatelltalesignatureofillnesstodoctorsandagenciesmonitoringnewoutbreaks.“Thistechnologyisanearlywarningsystem

2019-03-01 07:09:02

Changes caused by smoking block tumour-fighting genes

ByNicFlemingThefirstdirectevidencehasbeenfoundlinkingsmokingtoepigeneticchangesingenesthathelpfightcancer.Reversingthesechangesmayonedayprovideanewroutetotreatingcancer.Womenwithcervicalcancerareknown

2019-03-01 07:08:07

Modified contraceptive treats cancer of the uterus

ACONTRACEPTIVEdevicehasbeenadaptedtotreataformofcanceroftheuterus

2019-03-01 07:03:05

Love yourself to stay healthy

ByJoMarchantHavinghighself-esteemdoesn’tjustfeelgood

2019-03-01 06:19:02

Daily choices can affect long-term happiness

ByJessicaHamzelouChoosewiselywhenconsideringapartner

2019-03-01 06:19:01

Anti-dengue mosquitoes to hit Australia and Vietnam

MOSQUITOESinfectedwithbacteriathatstopthemtransmittingthedengueviruswillbereleasedintothewildnextyear.Some100millionpeopleinthetropicsgetdenguefevereachyear

2019-03-01 06:15:01

Enzyme-blocker boosts memory in old mice

ByAndyCoghlanElderlymicewithmemoriesaddledbyagecouldrememberaswellastheiryoungercounterpartsafterreceivingadrugthatblocksabrainenzyme.Thefindingcouldonedayhelppeoplewithmemory-impairment.“Itshowsthatn

2019-03-01 06:08:01

Jaundice at birth may be linked to autism

ByAndyCoghlanBabiestreatedforjaundicearemorelikelytodevelopautismthanotherinfants

2019-03-01 05:10:01

Have gene findings taken the stigma from ADHD?

ByAndyCoghlanForthefirsttime

2019-03-01 04:19:07

Test tube baby pioneer wins medicine Nobel

ByAndyCoghlanUpdate:RobertEdwardsdiedon10April2013.Originalarticle

2019-03-01 04:11:05

Call for ban on codeine

THEwidelyusedpainkillercodeinedoesn’tworkinsomepeopleandcanbefatalinothers

2019-03-01 04:05:08

Antibody reverses final throes of cancer in mice

ByAndyCoghlanForthefirsttime

2019-03-01 03:17:03

New route to stem cell therapy opens up

ByAndyCoghlanStemcellsandmusclecellshavebeencreatedfromadultskincellsusinganewmethodthatisbothquickerandmoreefficientthanitspredecessor.Itisalsolikelytobesafer.Thetechniquemakesinducedpluripotentstemc

2019-03-01 02:19:01

When big pharma breaks the law, prosecute the CEO

ByPaulThackerPatientsafetywillremainatriskuntilbigpharma’stopexecutivesarebroughttobookfortheircompanies’actions

2019-03-01 02:17:05

Body organs can send status updates to your cellphone

ByDuncanGraham-RoweForcardiacpatientssuchasmyself

2019-03-01 02:12:05

Hunter-gatherers cared for first known ancient invalid

ByAndyCoghlanHewastoooldtohunt

2019-03-01 02:08:05

People with ME banned from giving blood in UK

BLOODtransfusionservicesintheUKlastweekbecamethelatesttobanpeoplewhohavehadMEorchronicfatiguesyndromefromgivingblood.NHSBloodandTransplant(NHSBT)

2019-03-01 02:01:06

Men beware: moving country could affect your libido

ByJessicaHamzelouCONSIDERINGmovingcountry?Pickcarefullyifyouareaman

2019-03-01 01:10:03

Exoskeleton helps the paralysed walk again

ByMacGregorCampbellinBerkeley

2019-03-01 01:06:02

Ban all tobacco advertising, say US paediatricians

THEAmericanAcademyofPediatricsiscallingforabanonalltobaccoadvertisingintheUS